PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001480G0400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family ERF
Protein Properties Length: 243aa    MW: 25643.6 Da    PI: 5.6946
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001480G0400genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP259.95.8e-194698155
              AP2  1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
                     + ++GVr++ + grWv+e+r+p+++g  +r +lg++ tae Aa+a++aa+++l+g
  PH01001480G0400 46 PVFRGVRRRGSAGRWVCEVRVPCKRG--ARLWLGTYVTAEAAARAHDAAMLALRG 98
                     579******************98876..*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008473.4E-144698IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.103.4E-2747109IPR001471AP2/ERF domain
PROSITE profilePS5103221.99747107IPR001471AP2/ERF domain
SMARTSM003802.8E-2047113IPR001471AP2/ERF domain
SuperFamilySSF541712.42E-1747109IPR016177DNA-binding domain
CDDcd000181.41E-1148109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MDKGHENSSS SSSSASASSS PEQKTVWSSP PKRPAGRTKF RETRHPVFRG VRRRGSAGRW  60
VCEVRVPCKR GARLWLGTYV TAEAAARAHD AAMLALRGRS AACLNFPDSA WLLAVPPVLS  120
DLADVRRAAA EAVADFLRRE AANGSAAATV HEATSSLSAP SLADNAGSWA TSGDPSSVTL  180
DIPAALDSDM FELDLFGEMD LGMYYASLAQ GLLMEPPPPP ATGAYWDNGD CGDGGADVAL  240
WSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0956030.0FP095603.1 Phyllostachys edulis cDNA clone: bphyem126d08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957402.13e-89PREDICTED: dehydration-responsive element-binding protein 1H-like
SwissprotQ64MA13e-74DRE1A_ORYSJ; Dehydration-responsive element-binding protein 1A
TrEMBLK9M7N29e-95K9M7N2_WHEAT; AP2 domain CBF protein
STRINGMLOC_4956.18e-92(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19636261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51990.12e-31C-repeat-binding factor 4